Host taxon 10090
Protein NP_001104745.1
insulin-like growth factor I isoform 4 preproprotein
Mus musculus
Gene Igf1, UniProt P05017
>NP_001104745.1|Yersinia pseudotuberculosis IP 32953|insulin-like growth factor I isoform 4 preproprotein
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARSIRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.39 | 1.39472670521633 | 1.3e-15 | 28096329 | |
Retrieved 1 of 6 entries in 0.9 ms
(Link to these results)