Host taxon 10090
Protein NP_705746.1
insulin-induced gene 1 protein
Mus musculus
Gene Insig1, UniProt Q8BGI3
>NP_705746.1|Yersinia pseudotuberculosis IP 32953|insulin-induced gene 1 protein
MPRLHDHVWNYPSAGAARPYSLPRGMIAAAACPQGPGVPEPEHAPRGQRAGTTGCSARPGSWHHDLVQRSLVLFSFGVVLALVLNLLQIQRNVTLFPDEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.76 | -0.763740942534307 | 0.017 | 28096329 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)