Host taxon 10090
Protein NP_001296359.1
immune system released activating agent
Mus musculus
Gene Gm45915, UniProt B2CXA1
>NP_001296359.1|Yersinia pseudotuberculosis IP 32953|immune system released activating agent
MAGETVLQGCPLCPDHAEGDRSPRIGGSQRQSPLLEVTHTQCCHLILSCLYVWCPVTQSLYGAPEQHSFLSPLVLLHASQRPGTHPLAISLLTLPSQLVPEYTEVTSLQVIRILVNPSESANCLG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.65 | 1.64642535323678 | 0.00016 | 28096329 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)