Host taxon 10090
Protein NP_082455.1
immortalization up-regulated protein
Mus musculus
Gene 2200002D01Rik, UniProt Q9D809
>NP_082455.1|Yersinia pseudotuberculosis IP 32953|immortalization up-regulated protein
MEFDLAAALGPGSKKPEGAGHVGDPKHCPLKAPGGPEAGAAHKPRRVSGSSSDSSSSSSSSDSEAEGKEYAAGCKKHERSSDKAKKPKVKKEKMEKKEKKEKKEKEKKEKKAPH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.54 | -1.54261453393168 | 4.2e-10 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)