Host taxon 10090
Protein NP_001277395.1
histone H2B type 1-P isoform 2
Mus musculus
Gene Hist1h2bp, UniProt Q8CGP2
>NP_001277395.1|Yersinia pseudotuberculosis IP 32953|histone H2B type 1-P isoform 2
MPEPVKSVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.82 | -2.82305311800885 | 0.0023 | 28096329 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)