Host taxon 10090
Protein NP_835507.1
histone H2B type 1-M
Mus musculus
Gene H2bc14, UniProt P10854
>NP_835507.1|Yersinia pseudotuberculosis IP 32953|histone H2B type 1-M
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.59 | -2.59011420344809 | 4.6e-23 | 28096329 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)