Host taxon 10090
Protein NP_835504.1
histone H2B type 1-H
Mus musculus
Gene H2bc9, UniProt Q64478
>NP_835504.1|Yersinia pseudotuberculosis IP 32953|histone H2B type 1-H
MPEPAKSAPAPKKGSKKALTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.37 | -1.36945442338178 | 5.7e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)