Host taxon 10090
Protein NP_783595.1
histone H2B type 1-B
Mus musculus
Gene H2bc3, UniProt Q64475
>NP_783595.1|Yersinia pseudotuberculosis IP 32953|histone H2B type 1-B
MPEPSKSAPAPKKGSKKAISKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.15 | -2.14537208084413 | 6.5e-12 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)