Host taxon 10090
Protein NP_783593.1
histone H2A type 2-C
Mus musculus
Gene H2ac20, UniProt Q64523
>NP_783593.1|Yersinia pseudotuberculosis IP 32953|histone H2A type 2-C
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.85 | -1.84795755892592 | 3.2e-6 | 28096329 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)