Host taxon 10090
Protein NP_835585.3
histone H2A type 2-B
Mus musculus
Gene H2ac21, UniProt Q64522
>NP_835585.3|Yersinia pseudotuberculosis IP 32953|histone H2A type 2-B
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.03 | -2.02880612591396 | 2.4e-12 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)