Host taxon 10090
Protein NP_001171015.1
histone H2A type 1-O
Mus musculus
Gene Hist1h2an, UniProt C0HKE7
>NP_001171015.1|Yersinia pseudotuberculosis IP 32953|histone H2A type 1-O
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.49 | -2.49383755286179 | 6.1e-15 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)