Host taxon 10090
Protein NP_001171015.1
histone H2A type 1-O
Mus musculus
Gene H2ac7, UniProt C0HKE3
>NP_001171015.1|Yersinia pseudotuberculosis IP 32953|histone H2A type 1-O
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.27 | -2.2685825446362 | 1.0e-14 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)