Host taxon 10090
Protein NP_835490.1
histone H2A type 1-K
Mus musculus
Gene H2ac15, UniProt Q8CGP7
>NP_835490.1|Yersinia pseudotuberculosis IP 32953|histone H2A type 1-K
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTETHHKAKGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.86 | -1.85674022026504 | 5.5e-16 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)