Host taxon 10090
Protein NP_783589.1
histone cluster 1, H2aa
Mus musculus
Gene H2ac1, UniProt Q8CGP4
>NP_783589.1|Yersinia pseudotuberculosis IP 32953|histone cluster 1, H2aa
MSGPTKRGGKARAKVKSRSSRAGLQFPVGRVHRLLRQGNYAQRIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKTRITPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHKSQTK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.72 | -1.71978689742773 | 0.023 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)