Host taxon 10090
Protein NP_080074.1
histidine triad nucleotide-binding protein 3
Mus musculus
Gene Hint3, UniProt Q9CPS6
>NP_080074.1|Yersinia pseudotuberculosis IP 32953|histidine triad nucleotide-binding protein 3
MAEKQAGLVGEPDPEGSSPGTSESWNYDSNCVFCRVAAGQEPKTELFHCENEDLVCFKDIKPAALYHYLVVPKKHIGSCKDLNKDHIEMVESMVAAGKTMLERNNFTDFTDVRMGFHVPPFCSISHLHLHVIAPVKEFGFLSKLVYRQDSYWFVTVDYLLEKLRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.22 | -1.22362721123845 | 4.9e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)