Host taxon 10090
Protein NP_001334099.1
high mobility group protein HMGI-C isoform 2
Mus musculus
Gene Hmga2, UniProt P52927
>NP_001334099.1|Yersinia pseudotuberculosis IP 32953|high mobility group protein HMGI-C isoform 2
MSARGEGAGQPSTSAQGQPAAPVPQKRGRGRPRKQQQEPTCEPSPKRPRGRPKGSKNKSPSKAAQKKAETIGEKRPRGRPRKWPQQVVQKKPAQGGEFGERTRCHESQTSSLPHNPYGQELIASTLMGD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.59 | 1.58869495960939 | 0.022 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)