Host taxon 10090
Protein NP_034315.1
high affinity immunoglobulin epsilon receptor subunit gamma precursor
Mus musculus
Gene Fcer1g, UniProt P20491
>NP_034315.1|Yersinia pseudotuberculosis IP 32953|high affinity immunoglobulin epsilon receptor subunit gamma precursor
MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNTRSQETYETLKHEKPPQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.4 | 1.40345601595622 | 2.0e-8 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)