Host taxon 10090
Protein NP_080209.1
HIG1 domain family member 2A
Mus musculus
Gene Higd2a, UniProt Q9CQJ1
>NP_080209.1|Yersinia pseudotuberculosis IP 32953|HIG1 domain family member 2A
MAAPGPVSPEAPFDPSKPPVIEGFSPTVYSNPEGFKEKFIRKTRENPMVPIGCLGTAAALTYGLYCFHRGQSHRSQLMMRTRIAAQGFTVVAILLGLAASAMKSQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.58 | -0.582746005899485 | 0.04 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)