Host taxon 10090
Protein NP_058652.1
hemoglobin subunit beta-2
Mus musculus
Gene Hbb-b2, UniProt P02089
>NP_058652.1|Yersinia pseudotuberculosis IP 32953|hemoglobin subunit beta-2
MVHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.63 | -1.63431221119882 | 0.017 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)