Host taxon 10090
Protein XP_006532308.1
guanylate kinase isoform X1
Mus musculus
Gene Guk1, UniProt Q64520
>XP_006532308.1|Yersinia pseudotuberculosis IP 32953|guanylate kinase isoform X1
MAGPRPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIKKTDLCPIYIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIINDDLDKAYATLKQALSEEIKKAQGTGHA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.71 | -0.707133135956235 | 0.0017 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)