Host taxon 10090
Protein NP_032217.2
guanylate cyclase activator 2B preproprotein
Mus musculus
Gene Guca2b, UniProt O09051
>NP_032217.2|Yersinia pseudotuberculosis IP 32953|guanylate cyclase activator 2B preproprotein
MSRSQLWAAVVLLLLLQSAQGVYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.3 | -2.29946875455735 | 7.0e-18 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)