Host taxon 10090
Protein NP_808271.1
GSK-3-binding protein FRAT2
Mus musculus
Gene Frat2, UniProt Q8K025
>NP_808271.1|Yersinia pseudotuberculosis IP 32953|GSK-3-binding protein FRAT2
MPCRREEEEEAGDEAEGEEDDDSFLLLQQSVTLGGSTDVDRLIVQIGETLQLDTAHDRPASPCAAPGPPPAPPRVLAALSADKTGTPARRLLRPTGSAETGDPAPPGAVRCVLGERGRVRGRSAPYCVAEIAPGASALPGPGRRGWLPGSVASHRIQQRRWTAGGARAADDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATSPASAPGSGGGRSGPDSVTLQPSGAWL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.7 | -1.70481597164363 | 0.00071 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)