Host taxon 10090
Protein NP_032202.1
growth-regulated alpha protein precursor
Mus musculus
Gene Cxcl1, UniProt P12850
>NP_032202.1|Yersinia pseudotuberculosis IP 32953|growth-regulated alpha protein precursor
MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 5.66 | 5.66069007520019 | 4.8e-28 | 28096329 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)