Host taxon 10090
Protein NP_001300865.1
growth factor receptor-bound protein 2
Mus musculus
Gene Grb2, UniProt Q60631
>NP_001300865.1|Yersinia pseudotuberculosis IP 32953|growth factor receptor-bound protein 2
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.68 | 0.676400584209305 | 0.0063 | 28096329 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)