Host taxon 10090
Protein NP_032681.1
growth arrest and DNA damage-inducible protein GADD45 beta
Mus musculus
Gene Gadd45b, UniProt P22339
>NP_032681.1|Yersinia pseudotuberculosis IP 32953|growth arrest and DNA damage-inducible protein GADD45 beta
MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCLLVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.97 | 0.970653834055174 | 2.5e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)