Host taxon 10090
Protein NP_076019.2
group XIIB secretory phospholipase A2-like protein precursor
Mus musculus
Gene Pla2g12b, UniProt Q8VC81
>NP_076019.2|Yersinia pseudotuberculosis IP 32953|group XIIB secretory phospholipase A2-like protein precursor
MKLLCGFFLLWLGLVGNLAQSDPSPKEEESYSDWGLRQLRGSFESVNSYVDSFMELLGGKNGVCQYRCRYGKAPMPRPGYKAQEPNGCSSYFLGIKVPGSMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEAACDSLADTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.27 | -2.26920006341415 | 9.1e-16 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)