Host taxon 10090
Protein NP_036175.2
group IIF secretory phospholipase A2 isoform 1
Mus musculus
Gene Pla2g2f, UniProt Q9QZT4
>NP_036175.2|Yersinia pseudotuberculosis IP 32953|group IIF secretory phospholipase A2 isoform 1
MADGAQANPKGFRKKALVKHSTGRKSPSLRASPSKTSRSSLGMKKFFAIAVLAGSVVTTAHSSLLNLKSMVEAITHRNSILSFVGYGCYCGLGGRGHPMDEVDWCCHAHDCCYEKLFEQGCRPYVDHYDHRIENGTMIVCTELNETECDKQTCECDKSLTLCLKDHPYRNKYRGYFNVYCQGPTPNCSIYDPYPEEVTCGHGLPATPVST
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.43 | -1.43093892270293 | 2.0e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)