Host taxon 10090
Protein NP_034101.1
granulocyte colony-stimulating factor precursor
Mus musculus
Gene Csf3, UniProt P09920
>NP_034101.1|Yersinia pseudotuberculosis IP 32953|granulocyte colony-stimulating factor precursor
MAQLSAQRRMKLMALQLLLWQSALWSGREAVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 6.21 | 6.20764253314576 | 1.6e-14 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)