Host taxon 10090
Protein NP_081503.1
glyoxalase domain-containing protein 5
Mus musculus
Gene Glod5, UniProt Q9D8I3
>NP_081503.1|Yersinia pseudotuberculosis IP 32953|glyoxalase domain-containing protein 5
MCDPTSESQLWRSSSQIPSPCLICRLDHIVMTVKNIEDTTMFYSKILGMEVTTFKGNRKALCFGDQKFNLHEVGKEFDPKAAHPVPGSLDVCLITEAPLEEVIERLKAFDVPIEEGPVFRTGAKGPILSIYFRDPDRNLLEVSSYVTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.29 | -2.2906522865687 | 1.1e-18 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)