Bacterial taxon 273123
Protein WP_002210956.1
glycine zipper 2TM domain-containing protein
Yersinia pseudotuberculosis IP 32953
Gene slyB, UniProt Q66A45
>WP_002210956.1|Yersinia pseudotuberculosis IP 32953|glycine zipper 2TM domain-containing protein
MIKPFVAVAIAVVTLTGCANNNTLSGDVFTASQAKQVQTVSYGTLISVRPVTIQGGDDNNVVGAIGGAVLGGFLGNAVGGGTGRSLATAAGAVAGGIAGQGVQGALNRTDGVQLEIRKDDGQTILVVQKQGPTQFSVGQRVMLANSGSTITVSPR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.21 | -2.20696518663273 | 1.4e-10 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.12 | -2.12208279467943 | 6.0e-12 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.9 | -1.90457732830924 | 4.7e-12 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.09 | -1.09200170090759 | 0.0077 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.9 ms
(Link to these results)