Host taxon 10090
Protein NP_081205.1
glutathione-specific gamma-glutamylcyclotransferase 1
Mus musculus
Gene Chac1, UniProt Q8R3J5
>NP_081205.1|Yersinia pseudotuberculosis IP 32953|glutathione-specific gamma-glutamylcyclotransferase 1
MKQESASQSTPPPSLSPAPSSAQPSWGDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDREGCTWGVAYQVRGEQVNEALKYLNVREAVLGGYDTKEVTFYPQDTPDQPLTALAYVATPQNPGYLGPAPEEVIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLEAIVDAVGTLLPCSYLPEQPLALT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.33 | 1.33387272336744 | 0.044 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)