Host taxon 10090
Protein NP_080948.2
glutathione S-transferase Mu 7 isoform 1
Mus musculus
Gene Gstm7, UniProt Q80W21
>NP_080948.2|Yersinia pseudotuberculosis IP 32953|glutathione S-transferase Mu 7 isoform 1
MPMTLGYWDIRGLAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNADFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEAKCLDAFPNLKDFIARFEGLKKISDYMKTSRFLPRPMFTKMATWGSN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.93 | -2.92714246525498 | 6.3e-10 | 28096329 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)