Host taxon 10090
Protein NP_032209.1
glutathione S-transferase Mu 2
Mus musculus
Gene Gstm2, UniProt P15626
>NP_032209.1|Yersinia pseudotuberculosis IP 32953|glutathione S-transferase Mu 2
MPMTLGYWDIRGLAHAIRLLLEYTDTSYEDKKYTMGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHNLCGETEEERIRVDILENQAMDTRIQLAMVCYSPDFEKKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKVTYVDFLVYDVLDQHRIFEPKCLDAFPNLKDFMGRFEGLKKISDYMKSSRFLSKPIFAKMAFWNPK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.55 | -1.55257224693751 | 1.5e-8 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)