Host taxon 10090
Protein NP_034488.1
glutathione S-transferase Mu 1 isoform 2
Mus musculus
Gene Gstm1, UniProt P10649
>NP_034488.1|Yersinia pseudotuberculosis IP 32953|glutathione S-transferase Mu 1 isoform 2
MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.07 | -2.07203451989878 | 4.1e-17 | 28096329 | |
Retrieved 1 of 2 entries in 0.3 ms
(Link to these results)