Host taxon 10090
Protein NP_001316789.1
glutathione peroxidase 3 isoform 2 precursor
Mus musculus
Gene Gpx3, UniProt P46412
>NP_001316789.1|Yersinia pseudotuberculosis IP 32953|glutathione peroxidase 3 isoform 2 precursor
MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYUGLTDQYLGFLGSPGCPQTCSVDQDGLKLRSACLLNAEIKELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPVMRWYHRTTVSNVKMDILSYMRRQAALSARGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1 | 1.00118185139245 | 3.6e-8 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)