Host taxon 10090
Protein NP_109602.2
glutathione peroxidase 2
Mus musculus
Gene Gpx2, UniProt Q9JHC0
>NP_109602.2|Yersinia pseudotuberculosis IP 32953|glutathione peroxidase 2
MAYIAKSFYDLSAVGLDGEKIDFNTFRGRAVLIENVASLUGTTTRDYNQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFSLTQKCDVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRSFQTINIEPDIKRLLKVAI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.88 | 1.87696174312746 | 4.1e-12 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)