Host taxon 10090
Protein NP_001316456.1
glutathione peroxidase 1 isoform 2
Mus musculus
Gene Gpx1, UniProt P11352
>NP_001316456.1|Yersinia pseudotuberculosis IP 32953|glutathione peroxidase 1 isoform 2
MCAARLSAAAQSTVYAFSARPLTGGEPVSLGSLRGKVLLIENVASLUGTTIRDYTEMNDLQKRLGPRGLVVLGFPCNQFGHQNGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPTPSDDPTALMTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIETLLSQQSGNS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.43 | 0.426130261429037 | 0.032 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)