Host taxon 10090
Protein NP_001034332.3
glutamate-rich protein 4
Mus musculus
Gene Erich4, UniProt Q3UNU4
>NP_001034332.3|Yersinia pseudotuberculosis IP 32953|glutamate-rich protein 4
MEPWVQLKQAGLEPSGLGPLPKALRVPPPEGNPGQALMSSGAELGGARELILWIWEELGNLRRVDVQLLGQLCDLGLEMGTFREELVTILEEEEEEEEQEEKSCVEENKGPEEKQDEERSRSSYPAQRLPDFEMTI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.32 | -1.32076508326581 | 0.0088 | 28096329 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)