Host taxon 10090
Protein NP_001034281.1
glia maturation factor gamma isoform a
Mus musculus
Gene Gmfg, UniProt Q9ERL7
>NP_001034281.1|Yersinia pseudotuberculosis IP 32953|glia maturation factor gamma isoform a
MSDSLVVCEVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQNISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTETWLKEKLAFFR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.04 | 1.0381393235081 | 0.013 | 28096329 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)