Host taxon 10090
Protein NP_001152769.1
germinal center-associated signaling and motility protein isoform 1
Mus musculus
Gene Gcsam, UniProt Q6RFH4
>NP_001152769.1|Yersinia pseudotuberculosis IP 32953|germinal center-associated signaling and motility protein isoform 1
MGNCLQRTTRWQLDMQETPWNLRLSAKGRTCRYFRGWSCCHSVEGCSCLPWKNIRTFKARQESPKQNEGMTSAPVQDNANETYTEELCYILVDHEAVRGRPSVNPAEGFYENISNKAERHKESSRGTETEYSVLRFPSPPQPLPSTDDEYELLMPSRFSSHAFQQPRPLTTPYETHFSYPQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.71 | -1.70750382272508 | 8.9e-7 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)