Host taxon 10090
Protein NP_112478.1
GDP-L-fucose synthase
Mus musculus
Gene Tsta3, UniProt P23591
>NP_112478.1|Yersinia pseudotuberculosis IP 32953|GDP-L-fucose synthase
MGEPHGSMRILVTGGSGLVGRAIQKVVADGAGLPGEEWVFVSSKDADLTDAAQTQALFQKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHINDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHSSNFGYSYAKRMIDVQNRAYFQQHGCTFTAVIPTNVFGPYDNFNIEDGHVLPGLIHKVHLAKSSDSALTVWGTGKPRRQFIYSLDLARLFIWVLREYSEVEPIILSVGEEDEVSIKEAAEAVVEAMDFNGEVTFDSTKSDGQYKKTASNGKLRSYLPDFRFTPFKQAVKETCTWFTDNYEQARK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.78 | -0.783555665092498 | 0.0034 | 28096329 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)