Host taxon 10090
Protein NP_032401.1
gastrotropin
Mus musculus
Gene Fabp6, UniProt P51162
>NP_032401.1|Yersinia pseudotuberculosis IP 32953|gastrotropin
MAFSGKYEFESEKNYDEFMKRLGLPGDVIERGRNFKIITEVQQDGQDFTWSQSYSGGNIMSNKFTIGKECEMQTMGGKKFKATVKMEGGKVVAEFPNYHQTSEVVGDKLVEISTIGDVTYERVSKRLA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -8,05 | -8.05224292704883 | 1,2e-32 | 28096329 | |
Retrieved 1 of 1 entries in 1,2 ms
(Link to these results)