Host taxon 10090
Protein NP_034429.1
ganglioside GM2 activator precursor
Mus musculus
Gene Gm2a, UniProt Q60648
>NP_034429.1|Yersinia pseudotuberculosis IP 32953|ganglioside GM2 activator precursor
MHRLPLLLLLGLLLAGSVAPARLVPKRLSQLGGFSWDNCDEGKDPAVIKSLTIQPDPIVVPGDVVVSLEGKTSVPLTAPQKVELTVEKEVAGFWVKIPCVEQLGSCSYENICDLIDEYIPPGESCPEPLHTYGLPCHCPFKEGTYSLPTSNFTVPDLELPSWLSTGNYRIQSILSSGGKRLGCIKIAASLKGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.33 | -0.331788736779387 | 0.016 | 28096329 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)