Host taxon 10090
Protein NP_079774.1
gamma-secretase subunit PEN-2
Mus musculus
Gene Psenen, UniProt Q9CQR7
>NP_079774.1|Yersinia pseudotuberculosis IP 32953|gamma-secretase subunit PEN-2
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLAPAYTEQSQIKGYVWRSAVGFLFWVIILATWITIFQIYRPRWGALGDYLSFTIPLGTP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.77 | -0.770263158361404 | 0.047 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)