Host taxon 10090
Protein NP_663441.1
gamma-glutamylaminecyclotransferase
Mus musculus
Gene Ggact, UniProt Q923B0
>NP_663441.1|Yersinia pseudotuberculosis IP 32953|gamma-glutamylaminecyclotransferase
MAHIFVYGTLKRGQPNHKVMLDHSHGLAAFRGRGCTVESFPLVIAGEHNIPWLLYLPGKGHCVTGEIYEVDEQMLRFLDDFEDCPSMYQRTALQVQVLEWEGDGDPGDSVQCFVYTTATYAPEWLFLPYHESYDSEGPHGLRYNPRENR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.41 | -1.40501223042387 | 6.2e-6 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)