Host taxon 10090
Protein NP_079898.2
galectin-2
Mus musculus
Gene Lgals2, UniProt Q9CQW5
>NP_079898.2|Yersinia pseudotuberculosis IP 32953|galectin-2
MSEKFEVKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETLNLHFNPRFDESTIVCNTSEGGRWGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.15 | -2.1510700294096 | 4.6e-20 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)