Host taxon 10090
Protein NP_032085.1
G0/G1 switch protein 2
Mus musculus
Gene G0s2, UniProt Q61585
>NP_032085.1|Yersinia pseudotuberculosis IP 32953|G0/G1 switch protein 2
MESVQELIPLAKEMMAQKPRGKLVKLYVLGSVLALFGVVLGLVETVCSPFTAASRLRDQEAAVVELREACEQQSLHKQALLAGGKAQEATLCSRALSLRQHAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.85 | 1.85004737060925 | 2.9e-7 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)