Host taxon 10090
Protein NP_001104543.1
FXYD domain-containing ion transport regulator 5 isoform a precursor
Mus musculus
Gene Fxyd5, UniProt P97808
>NP_001104543.1|Yersinia pseudotuberculosis IP 32953|FXYD domain-containing ion transport regulator 5 isoform a precursor
MSLSSRLCLLTIVALILPSRGQTPKKPTSIFTADQTSATTRDNVPDPDQTSPGVQTTPLIWTREEATGSQTAAQTETQQLTKMATSNPVSDPGPHTSSKKGTPAVSRIEPLSPSKNFMPPSYIEHPLDSNENNPFYYDDTTLRKRGLLVAAVLFITGIIILTSGKCRQLSQFCLNRHR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.34 | 1.34450871433076 | 9.9e-8 | 28096329 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)