Host taxon 10090
Protein NP_032583.1
FXYD domain-containing ion transport regulator 3 precursor
Mus musculus
Gene Fxyd3, UniProt Q61835
>NP_032583.1|Yersinia pseudotuberculosis IP 32953|FXYD domain-containing ion transport regulator 3 precursor
MQEVVLSLLVLLAGLPTLDANDPENKNDPFYYDWYSLRVGGLICAGILCALGIIVLMSGKCKCKFRQKPSHRPGEGPPLITPGSAHNC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.8 | -0.796490399637338 | 0.019 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)