Bacterial taxon 273123
Protein WP_002211331.1
formate transporter FocA
Yersinia pseudotuberculosis IP 32953
Gene focA, UniProt Q66CJ4
>WP_002211331.1|Yersinia pseudotuberculosis IP 32953|formate transporter FocA
MKADNPFDALLPSAMAKVAEDAGVYKATKHPMTTFYLAITAGVFISIAFVFYITATTGTAGVPFGFAKLVGGICFSLGLMLVVVCGGDLFTSTVLTTVAKASGRITWRQLATNWVNVYIGNLFGALFFVGLIWFAGQYTVANGQWGLNVLQTAEHKLHHTFIEAVCLGILANLMVCLAVWMSYSGRTITDKMLAMILPVGMFVASGFEHSIANMFMIPLGIVIKNFASPEFWQAIGSAPEQFAHLTVSNFIIDNLIPVTIGNIIGGGLLVGLTYWVIYLRGDQQH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.76 | 2.75581140064556 | 1.1e-29 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.73 | 2.73387455906375 | 1.4e-21 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.05 | 1.05343012719752 | 4.1e-5 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.79 | 0.789528825881777 | 0.0027 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 1.3 ms
(Link to these results)